Seite auswählen

"event" : "MessagesWidgetMessageEdit", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1677804 .lia-rating-control-passive', '#form_4'); "triggerEvent" : "click", "action" : "rerender" LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); ;(function($) { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }); "action" : "rerender" "event" : "kudoEntity", "entity" : "1677616", ] "action" : "rerender" { } { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "revokeMode" : "true", "action" : "rerender" ] } ] ], "event" : "ProductAnswerComment", } "action" : "rerender" "parameters" : { { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/62553","ajaxErrorEventName":"LITHIUM:ajaxError","token":"aTRYygGGw1GWV-W1t-Z3TKCr2lwFQf1_MUNcR4dt2CQ. }, "event" : "expandMessage", } LITHIUM.Dialog.options['424451256'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "event" : "addMessageUserEmailSubscription", { "event" : "addThreadUserEmailSubscription", }, } ] } { "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_17c7c7c1715279","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_17c7c7c1715279_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/CallYa/thread-id/62553&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"TwSh06rWzVzCe-ZVaz86FJ_4iEXrlQh88FRmtKrAXbs. }, "revokeMode" : "true", ], }, "actions" : [ "kudosable" : "true", $(document).ready(function(){ ] ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "truncateBody" : "true", { } "componentId" : "kudos.widget.button", }; "event" : "unapproveMessage", ] "event" : "ProductAnswerComment", "actions" : [ "actions" : [ "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", "actions" : [ { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1676295,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { { } ] { "entity" : "1677804", LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } { "activecastFullscreen" : false, { } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { ] "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "addThreadUserEmailSubscription", "action" : "rerender" } { "revokeMode" : "true", "actions" : [ $(event.data.selector).removeClass('cssmenu-open'); Gratis SIM-Karten: o2 Freikarte Vodafone … "event" : "kudoEntity", ] "showCountOnly" : "false", }, "useCountToKudo" : "false", $('.css-menu').removeClass('cssmenu-open') ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" watching = false; Jetzt würde ich gerne wissen, was von beiden zutrifft. }, "kudosLinksDisabled" : "false", "action" : "rerender" "}); } "action" : "rerender" }, "event" : "addThreadUserEmailSubscription", "selector" : "#kudosButtonV2_3", "context" : "envParam:quiltName", "actions" : [ "event" : "markAsSpamWithoutRedirect", ] }, LITHIUM.Loader.runJsAttached(); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" { ] "initiatorBinding" : true, } { "action" : "pulsate" Mobile Daten sehr langsam ... Seit etwa 11.12.2014 fühlt sich das mobile Internet unkomfortabel langsam an. } } "actions" : [ "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101001101" } "action" : "rerender" { } } { $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ { ] "context" : "envParam:entity", { "includeRepliesModerationState" : "false", Update vom Montag, 23.11.2020, 18.54 Uhr: Vodafone scheint das Problem langsam in den Griff zu bekommen. }, { "initiatorDataMatcher" : "data-lia-message-uid" }, lithstudio: [], { "message" : "1677804", "action" : "pulsate" { ] "action" : "rerender" "event" : "MessagesWidgetEditAction", "actions" : [ Hallo, ich habe seit kurzem in einem BQ Aquaris X Pro eine zweite SIM von 1&1 im Vodafone Netzt im Einsatzt. { ] { "action" : "pulsate" "context" : "", "action" : "rerender" "actions" : [ "action" : "pulsate" "quiltName" : "ForumMessage", }, { ] Bist du sicher, dass du fortfahren möchtest? }, ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); }, { "context" : "lia-deleted-state", "disableLinks" : "false", "action" : "rerender" "context" : "", "event" : "editProductMessage", "truncateBody" : "true", } { "actions" : [ }, "action" : "rerender" Fazit: es liegt nicht an meiner sim. "action" : "rerender" "eventActions" : [ ] { { "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" "event" : "deleteMessage", ] ] "event" : "removeThreadUserEmailSubscription", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { })(LITHIUM.jQuery); "action" : "rerender" "context" : "", Wir nutzen bisher Internet und Telefon über LTE von Vodafone, uns nervt aber insbesondere das es sehr langsam ist und auch das begrenzte Datenvolumen. "event" : "QuickReply", "action" : "rerender" "context" : "", { } "action" : "rerender" }, Vodafone hat monatelang zigtausenden Kunden unberechtigte Kosten für mobile Daten in Rechnung gestellt und keiner hat es bemerkt - bis auf Areamobile. Bist du sicher, dass du fortfahren möchtest? "disallowZeroCount" : "false", "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ "action" : "pulsate" }, Fazit: es liegt nicht an meiner sim. "actions" : [ } Execute whatever should happen when entering the right sequence LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); ], }, } ] }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] "disableLinks" : "false", "action" : "rerender" "actions" : [ .attr('aria-hidden','true') "context" : "", "revokeMode" : "true", $(document).ready(function(){ var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "event" : "unapproveMessage", "disableLinks" : "false", "displaySubject" : "true", } { { "context" : "envParam:quiltName", "event" : "approveMessage", "context" : "", if (element.hasClass('active')) { "includeRepliesModerationState" : "false", ] { { "action" : "rerender" { ] LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234512}); ] } else { "closeEvent" : "LITHIUM:lightboxCloseEvent", } "event" : "deleteMessage", { ] "revokeMode" : "true", "event" : "ProductMessageEdit", // Set start to true only if the first key in the sequence is pressed "context" : "", "action" : "pulsate" "action" : "rerender" }); "linkDisabled" : "false" }, ] "action" : "rerender" } "actions" : [ // Reset the conditions so that someone can do it all again. } var keycodes = { ] "disallowZeroCount" : "false", "truncateBodyRetainsHtml" : "false", "event" : "addMessageUserEmailSubscription", { "actions" : [ "context" : "", "context" : "envParam:selectedMessage", "actions" : [ Versuchen Sie es nach der Verbindungsherstellung erneut. } { }, $('#custom-overall-notif-count').html(notifCount); "action" : "rerender" ] "actions" : [ "eventActions" : [ "parameters" : { "actions" : [ "context" : "", { "action" : "rerender" "event" : "ProductAnswer", "parameters" : { "action" : "rerender" // If watching, pay attention to key presses, looking for right sequence. "event" : "ProductAnswer", $(document).ready(function(){ $(document).keydown(function(e) { { "context" : "envParam:feedbackData", "actions" : [ "kudosLinksDisabled" : "false", "action" : "rerender" { "action" : "rerender" "action" : "rerender" { ] "context" : "envParam:quiltName,expandedQuiltName", { }, { } }, ] } { "actions" : [ Bist du sicher, dass du fortfahren möchtest? "actions" : [ "actions" : [ "showCountOnly" : "false", "eventActions" : [ ;(function($) { LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); "buttonDialogCloseAlt" : "Schließen", }, } { }, "eventActions" : [ if (typeof(Storage) !== "undefined") { } "event" : "approveMessage", "parameters" : { "actions" : [ } "useSimpleView" : "false", "actions" : [ "event" : "MessagesWidgetEditAnswerForm", "quiltName" : "ForumMessage", "disableKudosForAnonUser" : "false", "action" : "rerender" } "showCountOnly" : "false", "context" : "envParam:quiltName,product,contextId,contextUrl", $(document).ready(function(){ "action" : "rerender" } } "entity" : "1676697", }, "action" : "rerender" } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "action" : "rerender" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { "event" : "ProductAnswer", }); //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); Meine Tarifoptionen waren nicht richtig gebucht, warum auch immer. "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "selector" : "#kudosButtonV2_1", { "event" : "removeThreadUserEmailSubscription", "action" : "rerender" "context" : "", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); ] } } "event" : "kudoEntity", { "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "MessagesWidgetEditAnswerForm", } "actions" : [ Danke. "context" : "envParam:quiltName", Mir ist aber auch aufgefallen das auf dem Handy das Internet (über mobile Daten) langsamer geworden IST. "action" : "rerender" "action" : "pulsate" Tipp: Ist dieses Profil schon vorhanden ist, nutz es am besten. "initiatorDataMatcher" : "data-lia-message-uid" "context" : "", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" "entity" : "1676697", Seit 2. '; }, }, Execute whatever should happen when entering the right sequence "eventActions" : [ "action" : "rerender" } "action" : "rerender" }, ] "context" : "envParam:quiltName", ] "context" : "", "event" : "MessagesWidgetEditAnswerForm", "context" : "envParam:quiltName", LITHIUM.AjaxSupport.ComponentEvents.set({ ] }, ] }); "message" : "1676697", { "}); "dialogContentCssClass" : "lia-panel-dialog-content", }, })(LITHIUM.jQuery); } "initiatorDataMatcher" : "data-lia-kudos-id" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1677804,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "MessagesWidgetEditAction", ] { { } "context" : "envParam:selectedMessage", { ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_17c7c7c1715279_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/CallYa/thread-id/62553&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "truncateBody" : "true", { '; ', 'ajax'); "}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); "actions" : [ }); }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "", "action" : "rerender" "useSubjectIcons" : "true", "event" : "expandMessage", }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/62553","ajaxErrorEventName":"LITHIUM:ajaxError","token":"vSnBfPImU3dvC01AS_1qZ6pyaqfWc6uWBhwHzFED8RE. "actions" : [ "disableLabelLinks" : "false", "action" : "rerender" { lithadmin: [] "actions" : [ }, }, } element.addClass('active'); "action" : "pulsate" ] { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, $('.lia-button-wrapper-searchForm-action').removeClass('active'); ;(function($) { { "disableLinks" : "false", { LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); { }, "linkDisabled" : "false" } } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); logmein: [76, 79, 71, 77, 69, 73, 78], "includeRepliesModerationState" : "false", ], } "useTruncatedSubject" : "true", { LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; { }); { { "quiltName" : "ForumMessage", }, ] { "kudosLinksDisabled" : "false", { ] "event" : "addThreadUserEmailSubscription", "action" : "rerender" { "action" : "rerender" "actions" : [ "actions" : [ "event" : "markAsSpamWithoutRedirect", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ Nun habe ich seit dem ersten Tag das Problem das das Internet sehr langsam ist Durchschnittlich 2mbits im Download und 4mbits im Upload. }); "initiatorBinding" : true, } "truncateBodyRetainsHtml" : "false", "action" : "rerender" }, }, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); "useSimpleView" : "false", "action" : "addClassName" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "displayStyle" : "horizontal", "truncateBodyRetainsHtml" : "false", }, }, "event" : "MessagesWidgetEditAction", "action" : "rerender" "context" : "", { "selector" : "#kudosButtonV2_4", { }, }, "linkDisabled" : "false" { }); "context" : "", } "event" : "approveMessage", "useSubjectIcons" : "true", "}); "actions" : [ } else { .attr('aria-expanded','false') { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); watching = false; { "truncateBodyRetainsHtml" : "false", } ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { } ] "context" : "", { { "action" : "rerender" } "action" : "rerender" LITHIUM.Dialog.options['-663192136'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "editProductMessage", }, $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ }, ] var keycodes = { "event" : "MessagesWidgetEditAnswerForm", "kudosable" : "true", { "context" : "", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); "context" : "envParam:entity", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } }, { "event" : "ProductAnswerComment", "context" : "", LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "MessagesWidgetEditAction", ] }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { { "eventActions" : [ "action" : "rerender" { \\n\\t\\t\\t\\t\\t\\tDer gewünschte Vorgang konnte leider nicht abgeschlossen werden.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_17c7c7c19ff0f8', 'disableAutoComplete', '#ajaxfeedback_17c7c7c1715279_0', 'LITHIUM:ajaxError', {}, 'ziYJAL8j-SANEOhqS9SZSK5hcnchBtUrxsXPbkYvo7E. "eventActions" : [ "event" : "MessagesWidgetEditAnswerForm", "actions" : [ "action" : "addClassName" { "action" : "rerender" }, } ', 'ajax'); "eventActions" : [ "context" : "envParam:quiltName,expandedQuiltName", { var key = e.keyCode; LITHIUM.Dialog({ } "useSubjectIcons" : "true", } { }); }, { "event" : "ProductAnswer", "useSimpleView" : "false", "eventActions" : [ } { "action" : "rerender" // console.log(key); // console.log('watching: ' + key); } LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ ] "actions" : [ Nun habe ich seit dem ersten Tag das Problem das das Internet sehr langsam ist Durchschnittlich 2mbits im Download und 4mbits im Upload. "messageViewOptions" : "1111110111111111111110111110100101001101" "eventActions" : [ // Oops. { "revokeMode" : "true", { "forceSearchRequestParameterForBlurbBuilder" : "false", } "event" : "ProductAnswerComment", }, { }, "useCountToKudo" : "false", LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); { { "actions" : [ } "action" : "rerender" }, })(LITHIUM.jQuery); } "action" : "addClassName" ] { }, } "event" : "ProductAnswerComment", } "context" : "", }); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] { "action" : "rerender" { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/62553","ajaxErrorEventName":"LITHIUM:ajaxError","token":"LtyIno34msRHXMmhpQ9S544leTXaTAszCkkRrasfd1c. { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "initiatorBinding" : true, "actions" : [ LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1676295}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1676697}},{"elementId":"link_20","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1676697}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1676781}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1677616}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1677804}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2504044}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519298}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519069}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518535}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2517764}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519947}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518973}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518744}},{"elementId":"link_48","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518298}},{"elementId":"link_50","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518127}},{"elementId":"link_52","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2517837}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2517792}},{"elementId":"link_57","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516597}},{"elementId":"link_59","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516406}},{"elementId":"link_61","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516271}}]); { if ( key == neededkeys[0] ) { "event" : "MessagesWidgetEditAction", ] "event" : "ProductAnswerComment", "action" : "rerender" })(LITHIUM.jQuery); // Pull in global jQuery reference "eventActions" : [ { "context" : "", "event" : "deleteMessage", { }, "context" : "lia-deleted-state", } "action" : "rerender" "action" : "pulsate" "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" }, ] }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1676781,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten.

Aufrechnung Mit Verjährter Forderung Mietkaution, Th Aschaffenburg Studienbüro, Großer Kohlweißling Raupe Giftig, Knoppers Riegel Werbung 2021 Darsteller, Sims 4 Insect Farm, Icon Theme Shopify, Haus Mieten Bremen Provisionsfrei, Uni Halle Bibliothek Corona, Bildungsurlaub Brandenburg Yoga, Anmeldung Berufsschule Baden-württemberg, Geburten Deutschland 2020,